SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022756 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022756
Domain Number 1 Region: 186-460
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.44e-79
Family Mitochondrial carrier 0.0000684
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily EF-hand 4.87e-28
Family Calmodulin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022756   Gene: ENSLAFG00000005089   Transcript: ENSLAFT00000033386
Sequence length 469
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:29962820:29971496:-1 gene:ENSLAFG00000005089 transcript:ENSLAFT00000033386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCLCLYVPLTGEAQTEFQYFESKGLPAELKSIFKLSAFIPSQEFSTYRQWKQKIVQAGD
KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE
KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE
RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRTNNMCIIGGFTQMIREGGVR
SLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP
MEVLKTRMALRKTGQYSGMLDCARKILAKEGIAAFYKGYVPNMLGIIPYAGIDLAVYETL
KNAWLQRYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS
SLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences G3U4J8
XP_003407750.1.64505 ENSLAFP00000022756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]