SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023215 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023215
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily RUN domain-like 6.15e-30
Family RUN domain 0.000000604
Further Details:      
 
Domain Number 2 Region: 431-526
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000959
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000023215
Domain Number - Region: 195-242
Classification Level Classification E-value
Superfamily Prefoldin 0.00994
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023215   Gene: ENSLAFG00000027122   Transcript: ENSLAFT00000034096
Sequence length 535
Comment pep:novel supercontig:loxAfr3:scaffold_3:42951371:42953029:-1 gene:ENSLAFG00000027122 transcript:ENSLAFT00000034096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RINERINLMNMAKLSIKGLIESALNLGRTLDSHYPPLQEHCLKHGLKAKKTSFGQNKSWE
PLELVEKLVPEAAEITASVKDLPGLQRPVGRERAWLALMQKELSEYMKALVSKKELLSEF
YEPSALLMEEEAIIVGLLVGLNVTATFRMKEDLDSEIGVTDFSMYLKDGNSSNGSEGDGQ
ITAILDQKNYVEELNRHLNAAVNNLQAEVDALEKPNTKLTEELAAAKNRIITFQEEMERV
KEESSYIRESNRKGPKQDRTFEGEARKHLKEETQLGLDIEKELEIQVGMKLEMELGMKML
EKDVCENHDALVSLRQQMDDLRALKHELAFKLQSSDLRVKQKSGLNSHLEEKTNQMAATI
KQLEERLCQAERGRQSAELEQNFGDKINSLQLEVEELTRQQNQLELELKQERERRLQNNR
NVPGKGSQKTESKMDGKHRIQEENVNLKNPLEKSHGLQSHPMDQQDQPLLSEKPQVCQLC
QEDDGSIKKNVCKNCKGTFCNACSTNELPLLEVQPERVCSSCLRYLMKQYSTSPS
Download sequence
Identical sequences G3U5V7
ENSLAFP00000023215 ENSLAFP00000023215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]