SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024463 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024463
Domain Number 1 Region: 98-344
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-63
Family Nuclear receptor ligand-binding domain 0.0000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024463   Gene: ENSLAFG00000022550   Transcript: ENSLAFT00000032403
Sequence length 346
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_51:9000671:9062377:1 gene:ENSLAFG00000022550 transcript:ENSLAFT00000032403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHCLQKKVLKSQCSCWSKKTCLEGKYALSNLRARKSKKLGKLKGIHEEQPQQQQALPPP
PPPQSPEEGTTYIAPMKEPSVNTALVPQLSTLSRALTPTPAMILENIEPEIVYAGYDSSK
PDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRS
YKHTNSQYLYFAPDLVFNEEKMHQSAMYELCQGMHQVSLQFVRLQLTFEEYTIMKVLLLL
STIPKDGLKSQAAFEEMRANYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDL
LEFCFYTFRESQALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G3U9F5
ENSLAFP00000024463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]