SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025390 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025390
Domain Number 1 Region: 827-880
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000302
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 2 Region: 467-644
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000011
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025390   Gene: ENSLAFG00000029910   Transcript: ENSLAFT00000025768
Sequence length 883
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_33:3929215:3937279:1 gene:ENSLAFG00000029910 transcript:ENSLAFT00000025768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELREGPLSTPPPPGDTGGKESRGPCSGTVV
DANSNSPAVPCRCCQEHGPGLGNRQDPSQEEEGAASPSDPGCSSSLSSCSDLSPDESPVS
VYLRDLPGDKDAHPQPSDIPLEQGSQLVSAGPATCSPDSFCCSPDSCSGASSPAGPALDS
NCNALTRSQDLPSPGLEEEDEGGEQDLPTSELSEADDGKIDAGQTEPSWKINPIWKIDTE
KTEAGWKITENNNSGTGWVIRYGTNSLLPLSPAPPRLAACPADPPAPHPAPPTPPAASPL
LVPRPLFFRFSADGRPLLEGGGAGAAGSLFLAPLAGWPGAGLRLLGAPSPPEEQLLPVRL
SPVGAYSPPARGTLPCLASPELALLLSPLFPRSSTFPAAAPPSRQVPAPPLPPPPRPPKA
PRWIRSPPPPPRLLRSSWSFAGVPGAQRLWMAEAQSGTGQLQEQKKGLLIAVSASVDKII
SHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSP
WSVVEASVKPGCSTRSLGTLYSQISRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQED
AGLLSLLYLPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLAPPQAP
APPGPPPALQQTVQALLHWGGRLAQSLRGASGEAPPGPAAPTSPPTPGSWWEQLTQASRV
YASGDTEGFTLPRWGPRHHGTAAEGAQERRLPTEEAAPGRGVWLGRLFGVPGGPMETETG
ALKSRRPSSWLPPTVSVLALVKRGVPPETPSSPEELEASAPSMAQPHRAVRALCDHTAAG
PEQLSFQRGEVLRVIATVDEDWLRCGRDGVEGLVPVGYTSLVL
Download sequence
Identical sequences G3UC32
ENSLAFP00000025390 ENSLAFP00000025390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]