SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025640 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025640
Domain Number 1 Region: 127-188
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 424-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.65e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 528-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 330-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000835
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025640   Gene: ENSLAFG00000006716   Transcript: ENSLAFT00000027829
Sequence length 582
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_91:474973:505277:1 gene:ENSLAFG00000006716 transcript:ENSLAFT00000027829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLLPFPGKAPCPKLPVPPTQKETPLPTAEITRLAVWAAVQAVERKLEAQAMRLLTLEGRT
GTNEKKIADCEKTAVEFANHLESKWVVLGTLLQEYGLLQRRLENMENLLKNRNFWILRLP
PGSNGEVPKVPVTFDDVAVHFSEQEWGNLSEWQKELYKNVMRGNYESLVSMDYAISKPDL
MSQMERGERPAVQEQEDSEEGETPADPSAERERQIILADKKDELKGDENGEMGSVWDKPD
DLLLGGEEVCILKAETCQRRKAPPNVPVRLEKPREYGPQIPFQNIVFMSRQCVNTAHFEE
ENTSIPDSSIPQVTFWCSGSLPAENPGGGRPFTCLECGKSFRLKINLVIHQRNHVKEGPY
ACAECEASFRHKQQLTLHQRGGGGSKPYQCPECDSSFSHKSSLTKHQITHTGERPYTCPE
CKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSRPSHLLRHQRTHTGERPFKCPECE
KSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLLEHRRIHTGERPYHCAECGKRFT
QKHHLLEHQRAHTGERPYPCAHCAKCFRYKQSLKYHLRTHAG
Download sequence
Identical sequences G3UCT2
ENSLAFP00000025640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]