SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026271 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026271
Domain Number 1 Region: 392-614
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-55
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 91-207
Classification Level Classification E-value
Superfamily BRCT domain 8.69e-20
Family DNA ligase 0.032
Further Details:      
 
Domain Number 3 Region: 193-311
Classification Level Classification E-value
Superfamily BRCT domain 1.45e-18
Family DNA topoisomerase II binding protein 1, TopBP1 0.047
Further Details:      
 
Domain Number 4 Region: 605-750
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000902
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026271   Gene: ENSLAFG00000007798   Transcript: ENSLAFT00000033902
Sequence length 871
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_42:7158409:7219993:-1 gene:ENSLAFG00000007798 transcript:ENSLAFT00000033902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STSNMTEEMPQIETRVILVQEAGKHEELTKAIKTVKIMEVPVIKIKESCPGKSDEKIKEI
KVPFVKMESVEEFEGLDSPEFENVFIVMDFQNPVFNHLYKADCRIIGPPVVLNCAQKGEP
LPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANYTH
GEKFRVAVSLGTPIMKAEWIYKAWERRNEQDFCAAADNFKNEFKVPPFQDCILSFLGFSD
EEKTNMEEMTEMQGGNHLPVGDERCTHLIVEENIVKELPFEPSEKLYVVKQEWFWGSIQM
DARAGETMYLYEKANTPELKKSVSLLSLNTPNSNRKRRRLKETLAQLSRETDMSPFPPRK
RPSAEHSLSIGSLLDISNTPESSINYGETPKSCTKSSKNSTPVPPKQSARWQVAKELYQT
ESNYVNILATIIQLFQVPLEEEGQRGGPILVPEEIKTIFGSIPDIFDVHSKIKDDLEDLI
INWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMRKETIIKCEKQKPRFHAFLKINQAKPE
CGRQSLVELLIRPVQRLPSVALLLNDLKKHTTDENPDKNTLEKAIGSLKEVMTHINEDKR
KTEAQKQIFDVFYEVDGCPANLLSSHRSLVQRVETVSLGEHPCDRGEQVTLFLFNDCLEI
ARKRHKVIGTFRSPHSHTRPPPPLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTE
QANVLLSFQMTSEELPKESWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTL
SKASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHSSVEGRSPSSNDKHVVSRLTSTSS
LAGIPSPSLISLPSFFERRSHTLSRSTTHLI
Download sequence
Identical sequences G3UEL3
ENSLAFP00000026271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]