SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027266 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027266
Domain Number 1 Region: 264-456
Classification Level Classification E-value
Superfamily Nudix 8.12e-45
Family NADH pyrophosphatase 0.001
Further Details:      
 
Domain Number 2 Region: 16-101
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-19
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027266   Gene: ENSLAFG00000032137   Transcript: ENSLAFT00000031757
Sequence length 462
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:16382348:16392383:-1 gene:ENSLAFG00000032137 transcript:ENSLAFT00000031757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIKANPKKEVISQFHCSAAEGDITKLTAILSHSPSLLNETSENGWTALMYAARNGHPD
VVQLLLEKGCDRSIVNKSRQTALDIAKFWGYKHIANLLANAKGGKKPWFLTNEVEECENY
FSRTLLDRKSEKRNNSDWLLTKESHPATVYILFSDLSPLVTLGGNKESFQQPEVRLCQLN
HTDIKDYLAQPEKITLIFLGVELEIKKELLNYAGEVPKDEEDGLVAWFALGIDPVAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGSATRIEEGGYKR
VCLKEDCPSLHGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPDMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDAR
WFTREQVIDVLTKGKQQAFFVPPSRAIAHQLIKHWIGMNANL
Download sequence
Identical sequences G3UHF8
XP_003405051.1.64505 XP_010587998.1.64505 ENSLAFP00000027266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]