SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027381 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027381
Domain Number 1 Region: 134-409
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.07e-76
Family Mitochondrial carrier 0.0000691
Further Details:      
 
Domain Number 2 Region: 6-109
Classification Level Classification E-value
Superfamily EF-hand 9.15e-23
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027381   Gene: ENSLAFG00000013828   Transcript: ENSLAFT00000035254
Sequence length 419
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_119:1039414:1059952:-1 gene:ENSLAFG00000013828 transcript:ENSLAFT00000035254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGISPEADADPDGGLDLEEFTRYLQERERRLLLMFHSLDRNQDGHIDVSEIQQSFRALGI
SISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVVYFWKHSTVLDIGECLTV
PDEFSEQEKQTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLDILGGLRS
MVREGGVCSLWRGNGINVLKIAPESAIKFMAYEQIKRAIRGQQETLHVQERFVAGSLAGA
TAQTIIYPMEVLKTRLTLRRTGQYRGLRDCARQILEQEGPRAFYRGYLPNMLGIVPYAGI
DLAVYEQILTKGPWCPRYCTGNTTMNVFMVVACGTISSTCGQIASYPLALVRTRMQAQAS
IEGAPQLSMLGLLRHILYQEGVRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR
Download sequence
Identical sequences G3UHS3
ENSLAFP00000027381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]