SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027933 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027933
Domain Number 1 Region: 44-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000103
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 965-1026
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000127
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 783-841
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 725-783
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000127
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 5 Region: 913-971
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000602
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 6 Region: 845-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000209
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 668-723
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000916
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027933   Gene: ENSLAFG00000030426   Transcript: ENSLAFT00000032247
Sequence length 1075
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_11:41773824:41781819:-1 gene:ENSLAFG00000030426 transcript:ENSLAFT00000032247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKWAGRPWLCLMLLLSLPQLCLDQEVLSGHSLHTPPEEGQGPEGVWGPWDQWASCSQPC
GVGVQRRSRICQLPTAQLHPGLPLPPRPPRHPEPQPPRGQGPRPQASRKTLPLYRPEPRG
RGGPLQSPASQLGREETQESQGARRSRVRDPIKPGMFGYGRVPFALPLHRNRRHPQRPPR
SELPQTSFRGEAPLPSLTPGAETSSPNQTPQTQLPTIELSAHTQSPPAEPPNSTISQTEV
PSRARPAASGPHPRNQASDTEPLLPTPFPGGSISFHVSPQPRVPNPQRQASPQVVGRRPN
PFTTVPRGRGQQSWEHWRPGGSLPGFHMEPAPHHPNGWLPLLSAGPHSSSRWSLFAPSSP
VPRCSGENEQLRACSQAPCPPEQPDPRALQCAAFDSQEFMGQLYQWEPFTEVQGSQRCEL
NCRPRGFRFYVRHTEKVQDGTLCQPGALDICVAGRCLSPGCDGILGSGRHPDGCGVCGGD
ESTCRVISGNLTDRGGPLGYQKILLIPAGASRLHIAQLQPSANYLALRGPGGRSIINGNW
AVDPPGSYTAGGTIFRYNRPPREEGTAESLSAEGPTTQPVDVYMIFQEENPGVFYQYVIS
SPPPNHESPTPEASNPQLQPEILRVESQPASVPRPARTPGTLQRQVRIPQMPAPPHPRTP
LGSPAGYWKRVGHSECSASCGKGVWRPIFLCVSRESGEELDDHSCATGARPPASPEPCHG
PPCPPYWEAGEWTSCSRSCGPGTQQRQLRCRQEFGGGGSSVPPERCGHLPRPNITQPCQL
RLCGHWEVRSPWSQCSVRCGRGQRSRQVRCVGNNGDEVSERECMSGPPRPPSREACDMGP
CTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGEARGAGQEEAGAGTSEQSCPPGSRPSD
MRACSLRPCEVTWCWYTGPWGECSSECGPGTQRRDIICVSKLGAEFNVTSPSNCSHLPRP
PALQPCQGRGCQDRWFSTPWSPCSRSCQGGIQTREVQCLTTNQTLSTRCPPHLRPSRKQP
CNSQPCSQRPDDQCKDSSPHCPLVVQARLCVYPYYTATCCRSCTHVLERSPPEPA
Download sequence
Identical sequences G3UJC5
ENSLAFP00000027933 XP_003409543.1.64505 XP_010587772.1.64505 XP_010587773.1.64505 ENSLAFP00000027933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]