SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028021 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028021
Domain Number 1 Region: 1120-1296
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.31e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00085
Further Details:      
 
Domain Number 2 Region: 680-797
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.88e-28
Family Pyk2-associated protein beta ARF-GAP domain 0.0027
Further Details:      
 
Domain Number 3 Region: 440-567
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-27
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 4 Region: 904-1035
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-22
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 5 Region: 1422-1560
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-19
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 6 Region: 7-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.09e-17
Family SAM (sterile alpha motif) domain 0.0000598
Further Details:      
 
Domain Number 7 Region: 578-679
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000101
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 8 Region: 1012-1112
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000938
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028021   Gene: ENSLAFG00000003991   Transcript: ENSLAFT00000031430
Sequence length 1705
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_18:38519259:38741915:-1 gene:ENSLAFG00000003991 transcript:ENSLAFT00000031430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVSEINVDIKDFLMSINLEQYLSHFRDFGLNTVKDCAAINDSLLHKIGISPTGHRRRI
LKQLQIILSKMQDTPIYANVHKTKKNDKTSENSHALSSDSCIELSDSGSAHTPSPTVTKH
LDQNDVSVESSQSLKSDDKLYLPVHSVPLPKEPHLDLGSSQDSSLGSENFKTESLITKKT
VDCTIKEQQTERADLTSENLSKLPNSDPECRSSPGFSISEASSGNGTNGLLAKPPPSPFF
QFQGEMVVNDLYVPSSPNLAPVRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISGSYLRE
RRNVTTSAGKFVAQQNSSEENSSSIFPYGETFLFQRLENSKKKSIKNEFWTHEETLKRET
TTERYMWNVRNHIYDNRTEKTSEDKVEDIWIPREDKNNVLIDSASESEYSTVEECFHSLR
RKNSKAPKSRTQKVLNLDPLTRHSYPCSSPSGNADSSTLPSYAISPYACFYGSPARRIKS
GWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAVSTVRVQGDNKFEVV
TTQRTFVFRAEKEEERNDWISILLNALKSQPLTSQSQAVVAPEKCGYLELRGYKAKIFTV
LSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAESEKE
KQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQ
HRSLGPKDSKVRSLKMDASIWSNELIEVTLIVMTTFKKPKDFWAGNLPKDEELHMDSPVE
KRKSFITQKYREGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGD
PVYSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIPSEGGLSQEFSQSTFLCDFLYQAPS
AASKLSSEKKLFEETNKKWCVLEGGFLSYYEHDKSTTPNGTININDVICLAIHKEDFYLS
TGPIFTFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPFVAENLTEADYDLIGQLYYK
DCHALDQWRKGWFAMDKSTLRFCLQMQEAQEDRMHLRRLQELTISTMLQNGEKLDVLLLV
EKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGL
GCKYIYQKNGDPLCISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLTKE
LYPYWVSALDTQDDKERIKKYGTFIRNLPTVNRATLAAIIEHLYRVQKCSEINHMNAHNL
AMAFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEEQVKQMDIENSFITKWKDTQVSQ
AGDLLIEVYVERKEPDCSIIIRISPIMEAEELTNDILAIKNIIPKKGDVWATFEVIENEE
LERPLHYTENVLEQVLQWSSLAEPGSAYLVVKQFLTIDTIRHYSVKIIKEGVLKIKEEPS
KILSGNKFQDRYFVLRDGYLFLYKDLKSSKHDKMFSLSSMKFYLGVKKKMKPPTSWGLTA
YSEKHHWHLCCDSLQTQMEWMASVFIAQHENDIWPPAGKERKRSITKNPKIGGLPLIPIQ
QERNTTLSRRNLESARAELERLRLSAKPDKEPVDPSLKERASIVAHCLEHKEDKLRNRTR
KHRSFNCLEDTGAEVPHGQQKFYKGVKTLRKTEDRKTEDRNSKATLDSDNKLPSKVIEEL
NVVLQRTRTLPKEFEDEQMLQKEIK
Download sequence
Identical sequences G3UJL2
ENSLAFP00000028021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]