SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028772 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028772
Domain Number 1 Region: 218-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000361
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 276-316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000852
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Domain Number 3 Region: 157-212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000567
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 29-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000283
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 5 Region: 118-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000567
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028772   Gene: ENSLAFG00000032333   Transcript: ENSLAFT00000032646
Sequence length 342
Comment pep:novel supercontig:loxAfr3:scaffold_16:436612:444625:-1 gene:ENSLAFG00000032333 transcript:ENSLAFT00000032646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTPNMLFLINVLLTLWMSCAEGQGKEPCNFPEIKHGKTYGENQPKQTFPVAMGKYLYYT
CDHSCVSALQSLWTRITCTEEGWSPIPKCRIIFRVFRTVLFSFGGNGHSSSSGQIDLKIL
CDTGYKLANDQSSITCTEDDWSSPPKCSSAVHPSGPDCPKLPTFANAILKDPEKQSYRSG
EQVEHECEKDFQLDGPHTVKCIKSRWIGSPTCRDSEGKCGFPPPFENGDITSFPLPMYAQ
GSTVEYQCQASHELQGDKITCRNGQWSEPQKCLDACVISEDMMEKNMQLRWKYDKKNYLK
TGDTFEFTCKRGYKEKMPRSIPAVKNHTLVKMCLYNQHTYIS
Download sequence
Identical sequences G3ULR3
ENSLAFP00000028772 ENSLAFP00000028772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]