SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000029389 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000029389
Domain Number 1 Region: 404-668
Classification Level Classification E-value
Superfamily NHL repeat 3.92e-50
Family NHL repeat 0.0000531
Further Details:      
 
Domain Number 2 Region: 287-381
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 70-132
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000147
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000029389   Gene: ENSLAFG00000026852   Transcript: ENSLAFT00000028412
Sequence length 668
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_36:6670841:6753397:-1 gene:ENSLAFG00000026852 transcript:ENSLAFT00000028412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSSCDEGNASSRCLDCQELCDNCVRAHQRVRLTKDHYIERGPPGPAAAAAAAQQLGLGPP
FPSSPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRECTMGRHGGHSFTYLQEALQ
DSRALTIQLLADAQQGRQAIQLSIEQAQAVAEQVEMKAKLVHSEVKAVTARHKKALEERE
CELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQVLEEGRALDILLARDRMLA
QVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSSGAFAPLTKATGDGLKRALQ
GKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVNDQQNGTYVVSYRPQLEGE
HLVSVTLCNQHIENSPFKVVVKSRSYVGIGLPGLSFGSEGDSDGKLCRPWGVSVDKEGYI
IVADRSNTRIQVFKPCGTFHHKFGALGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIF
TFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGRILVSDTRNHRIQLFGPDGVFLNKYGFE
GALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGV
AVDQEGRIIVADSRNHRVQMFESNGSFLCKFGSQGSGFGQMDRPSGIAVTPDGMIVVVDF
GNNRILIF
Download sequence
Identical sequences G3UNI0
ENSLAFP00000029389 ENSLAFP00000029389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]