SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|172363|estExt_Genewise1_human.C_40887 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|172363|estExt_Genewise1_human.C_40887
Domain Number 1 Region: 4-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.1e-69
Family Glutathione peroxidase-like 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|172363|estExt_Genewise1_human.C_40887
Sequence length 224
Sequence
MPSLRLGNTAPDFEAVTTAGPIKFHEWIGDSWAILFSHPGDFTPVCTTELGEVARRGPDF
ANRNVKVIGISANGLEEHHKWVKDINDYGSKVAPTDVQFPIIADPDRKISTLYDMLDEQD
ATNRDAKGLPFTIRTVFVIDPKKVIRLTLAYPASTGRNFDEILRVIDSLQLGDKHRITTP
VNWKKGDDVIVHPGVTNDEAKTLFPDYSQHLPYLRTTPLKVEKD
Download sequence
Identical sequences B0CY32
XP_001876637.1.58555 jgi|Lacbi1|172363|estExt_Genewise1_human.C_40887 29883.JGI172363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]