SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|174328|estExt_Genewise1_human.C_200095 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|174328|estExt_Genewise1_human.C_200095
Domain Number 1 Region: 4-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.49e-64
Family Glutathione peroxidase-like 0.000000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|174328|estExt_Genewise1_human.C_200095
Sequence length 219
Sequence
MVALVQRPAPAFKAEAVAKGTFLDISSSDFLGQWVVLLFYPMDFTFVCPTEILAFNDALP
RFKELNTTVFGVSTDSKFSHLAWANQPRKEGGLGPDLKLPLLADRSMRISRDYGVLLEDE
GIALRGLFIIDPKGILRQITVNDLPVGRSVEETIRLIQAFQFTDAYGEVCPANWTEGSKT
IKADPVAKLEYFTAVTDGQSNNHVNGEANGSVKKRARVD
Download sequence
Identical sequences B0DH61
jgi|Lacbi1|174328|estExt_Genewise1_human.C_200095 29883.JGI174328 XP_001883247.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]