SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|178653|estExt_Genewise1_worm.C_80203 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|178653|estExt_Genewise1_worm.C_80203
Domain Number 1 Region: 3-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.43e-35
Family Glutathione peroxidase-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|178653|estExt_Genewise1_worm.C_80203
Sequence length 148
Sequence
ATIDIGDSLPSLTLKNEKGEDVQVENLASEKGVILFLVPKADTPGCTNQACGFRDIYPDF
TSLNYDVYCLSADTPAAQTKWQTKKELPYPLLSDPKRLLISALGAGEGGKTKRSHFIFEQ
GGKLVDKKIPVKPADSPKLALDFIKSLQ
Download sequence
Identical sequences B0D611
29883.JGI178653 jgi|Lacbi1|178653|estExt_Genewise1_worm.C_80203 XP_001879248.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]