SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|181679|estExt_GeneWisePlus_human.C_11084 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|181679|estExt_GeneWisePlus_human.C_11084
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.81e-34
Family Thioltransferase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|181679|estExt_GeneWisePlus_human.C_11084
Sequence length 108
Sequence
MPVKTFSSFDDFKAVINGEKPVVIDFWATWCGPCRVISPVFEKLSDDLSFAGVEFYKVDV
DEQDQISQEVGVRAMPTFALFRKGEKVSELVGARPQELQSLVAKALTD
Download sequence
Identical sequences B0CNZ5
XP_001873590.1.58555 29883.JGI181679 jgi|Lacbi1|181679|estExt_GeneWisePlus_human.C_11084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]