SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|184771|estExt_GeneWisePlus_human.C_110166 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|184771|estExt_GeneWisePlus_human.C_110166
Domain Number 1 Region: 6-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.62e-58
Family Glutathione peroxidase-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|184771|estExt_GeneWisePlus_human.C_110166
Sequence length 161
Sequence
MSDSGFYSLKAERPGGKEYSFSELKGKVVLIVNVASKCGFTPQYKGLQDLYLKYKDQNFV
ILGFPCNQFGGQEPEDDKGIEEFCTLNHGVTFPLMKKSDVNGDNTNEVYKWLKEEKSGIF
GLTRIKWNFEKFLVDKEGNVVQRWASTTTPQAIDEEVAKLL
Download sequence
Identical sequences B0DA76
jgi|Lacbi1|184771|estExt_GeneWisePlus_human.C_110166 XP_001880701.1.58555 29883.JGI184771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]