SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|188517|estExt_GeneWisePlus_worm.C_40065 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|188517|estExt_GeneWisePlus_worm.C_40065
Domain Number 1 Region: 103-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.77e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.00046
Further Details:      
 
Domain Number 2 Region: 6-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.04e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|188517|estExt_GeneWisePlus_worm.C_40065
Sequence length 225
Sequence
MSSPAKPLVLYTAGTPNGYQATIFLEELKAVNPNVDYDAVKIDIGKNVQKEPWFLKLNPN
GRIPTLVDRSRGDFAVFETAAINLYLAQQYDKEFQFWFNPLEDADDYSEMLQWIFFAHGG
VGPMQGQSNHFNRFAPESIPYAKNRYLEETKRLYGVLQLRLADRDWLAGHGRGKYSLADI
KAFPWVRIHAFAGVESLDEWPAVKAWVERVGARPGVVAGLKVAGQ
Download sequence
Identical sequences B0CY53
29883.JGI188517 XP_001877094.1.58555 jgi|Lacbi1|188517|estExt_GeneWisePlus_worm.C_40065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]