SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|189591|estExt_GeneWisePlus_worm.C_60515 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|189591|estExt_GeneWisePlus_worm.C_60515
Domain Number 1 Region: 8-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.75e-26
Family Phosducin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|189591|estExt_GeneWisePlus_worm.C_60515
Sequence length 202
Sequence
MSINPNEDTEFNDALRKHGILPPREPTPPSPSPPPSPTFDDLLNDFTSSELQEFSEDAPD
DETERIIAAYRKQRLADERKEDKKGRFGRVYPIGREDYTREVTEASNVDEEDDDNEKGTG
VVCFLYKDGIPRSDRTFQHIRALATKYPRTKFVSIIGDKCIPNLPDTRVPMLIVYRKGDI
RNQIVAWGADRERRQEGMCPCH
Download sequence
Identical sequences B0D3B8
XP_001878556.1.58555 29883.JGI189591 jgi|Lacbi1|189591|estExt_GeneWisePlus_worm.C_60515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]