SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|189840|estExt_GeneWisePlus_worm.C_80159 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|189840|estExt_GeneWisePlus_worm.C_80159
Domain Number 1 Region: 11-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.25e-21
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|189840|estExt_GeneWisePlus_worm.C_80159
Sequence length 92
Sequence
MSFAKAFSPALREIRILCSQTGPASAGTRQFIVSKYPTIKQHNPDLPVLIREATGTPARV
FARFERGVEKHVELDNLSATDVETKVAQLLSS
Download sequence
Identical sequences A0A0C9XE78 B0D6H0
XP_001879571.1.58555 29883.JGI189840 jgi|Lacbi1|189840|estExt_GeneWisePlus_worm.C_80159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]