SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|191714|estExt_GeneWisePlus_worm.C_400093 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|191714|estExt_GeneWisePlus_worm.C_400093
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.24e-37
Family spliceosomal protein U5-15Kd 0.000000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|191714|estExt_GeneWisePlus_worm.C_400093
Sequence length 142
Sequence
MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMMMDETLYSVAEKVQNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEMIDIIETVY
RGASKGRGLVVSPKDYSTRYRY
Download sequence
Identical sequences B0DS96
jgi|Lacbi1|191714|estExt_GeneWisePlus_worm.C_400093 29883.JGI191714 XP_001886799.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]