SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|231608|e_gwh1.4.511.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|231608|e_gwh1.4.511.1
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.68e-29
Family Phosducin 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|231608|e_gwh1.4.511.1
Sequence length 132
Sequence
RMERVKEMQQNEHGRYTEITDEKEVVRVSAREPRCVVHFYHSQFKRCEIMDKHLARLAPK
YFNTRFFRVFVENVPWLVEKLAIKVLPCVICFKDGISKDRLTGFEELGNSDEFDTAVLEL
RLATSGVQYLLM
Download sequence
Identical sequences B0CYN1
29883.JGI231608 XP_001876743.1.58555 jgi|Lacbi1|231608|e_gwh1.4.511.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]