SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|238438|e_gwh1.33.127.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|238438|e_gwh1.33.127.1
Domain Number 1 Region: 15-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000032
Family Glutathione S-transferase (GST), N-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 159-230
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000282
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Lacbi1|238438|e_gwh1.33.127.1
Domain Number - Region: 78-154
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 0.053
Family Nitrogenase iron-molybdenum protein 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|238438|e_gwh1.33.127.1
Sequence length 248
Sequence
MITFYDISSNLPDKVWSPSTWKTRLTLNYKGIPYKTEFLELPDVQKFCIEKRIPPTRTWN
DGSPFYTFPVIHDPSTGVYLTDSLAIARYLEKTYPETPVIFPVGLDALQAAYTSACASEL
NSIWRIAVPELAKLFEGRALEYYRFSREKNVGKKLEEVAPVGEEKVADWNKLKEGFDNID
SWLNQNSVTGPFVMGDRIIWADFVLGGLLLLFKRMWGEDSGEWKDIKGWNGGRWEALLRG
LQPHSQIK
Download sequence
Identical sequences B0DP15
jgi|Lacbi1|238438|e_gwh1.33.127.1 29883.JGI238438 XP_001885759.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]