SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|240178|e_gwh1.52.47.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|240178|e_gwh1.52.47.1
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.01e-25
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|240178|e_gwh1.52.47.1
Sequence length 95
Sequence
STVSGNKVAIFSKSYCPYCANAKALFAKEFPGITPTVVELNLRKDGPEIQSYLLEKTGQR
TVPNVFVAHKHIGGNDDTQALFRAGKLAQLLRVRS
Download sequence
Identical sequences B0DW47
XP_001888160.1.58555 29883.JGI240178 jgi|Lacbi1|240178|e_gwh1.52.47.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]