SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|240633|e_gwh1.60.16.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|240633|e_gwh1.60.16.1
Domain Number 1 Region: 114-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.96e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.00077
Further Details:      
 
Domain Number 2 Region: 30-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.92e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|240633|e_gwh1.60.16.1
Sequence length 244
Sequence
MASPVSPTCLKEEQGKNLALHHLQIHFSERVSQWFLNSMDFSTCTQTVATVLYKTNVSFE
FIPVDISKGEQKAPEYLVIQPFGQGVRLQDDDGYIVYESRAIARYITAKYGDQGTPLLPK
DPKAYGLSEQAASIEAFNFHPHVSKAVAENMFKNGLTPDHAVYEAAISALDKHLDVYDTI
LAKQKYLAGDEITLADIFHVAYGSYLPAAGSNVIDTRGKWLSWFKEVSGRASWQAVKDGV
KSTT
Download sequence
Identical sequences B0DYG8
XP_001888994.1.58555 jgi|Lacbi1|240633|e_gwh1.60.16.1 29883.JGI240633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]