SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|243689|e_gww1.1.894.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|243689|e_gww1.1.894.1
Domain Number 1 Region: 24-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-20
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|243689|e_gww1.1.894.1
Sequence length 140
Sequence
MPLPIFRAQLRSTPANGHAAFLPHIRKLVFEFCNKWPSSENTRTFLLNDLQSLARQNPHV
EIVVRQRSQKEPIVRGFYVNNRDKVIPLNSLEVTGIHKKVRLLLDSSGAKIKPLKRRPVE
STTQAARGIWSGLHADRPTL
Download sequence
Identical sequences B0CQW0
XP_001873310.1.58555 29883.JGI243689 jgi|Lacbi1|243689|e_gww1.1.894.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]