SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|252249|e_gww1.25.215.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|252249|e_gww1.25.215.1
Domain Number 1 Region: 42-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.75e-49
Family Glutathione peroxidase-like 0.00000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|252249|e_gww1.25.215.1
Sequence length 215
Sequence
FTPTSAAIFVAAGVGLFFYFRYEKTRLLEEREKERMNKQYGRPQIGGPFSLTTDTGKPFT
DEDLLGKWSLVYFGFTNCPDICPAELDKVTSVLDSIGTYPLASIFQPLFITVDPVRDSQS
RISRYLQDFHPSFTGLFGSYDATKAVCKAYRVYFSTPPNADPNGDYLVDHSIFVYLMDPH
GKFVEAFGQSVGEEVVKTKINEAISQWQQETGKKA
Download sequence
Identical sequences B0DKB1
jgi|Lacbi1|252249|e_gww1.25.215.1 XP_001884427.1.58555 29883.JGI252249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]