SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|291218|estExt_fgenesh2_pm.C_150009 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|291218|estExt_fgenesh2_pm.C_150009
Domain Number 1 Region: 149-245
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.74e-32
Family Thioltransferase 0.0002
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.01e-23
Family Thioltransferase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|291218|estExt_fgenesh2_pm.C_150009
Sequence length 246
Sequence
MSKTNFYDVTSPTEFQELLSADLNRVSVINFWAPWAEPCKQMNEVVKELSKKYQQTLFLQ
VEAEEQADIAESFDIEAVPTFIILRGHLLLDRVAGADAAALTKSVEKHTAGPSYNPQSRT
DKAPAPAPTTVPSSLQDGDSKQPESEAQLNERLRGLMNQSKVVVFIKGSPQEPRCGFSRK
IVGLLKDKGVEYKHFDILTDESVRQGLKKLNDWPTFPQLIINGELVGGLDIVQEMAENGE
LEQALA
Download sequence
Identical sequences B0DE05
jgi|Lacbi1|291218|estExt_fgenesh2_pm.C_150009 29883.JGI291218 XP_001882238.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]