SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|295178|estExt_fgenesh2_pg.C_330011 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|295178|estExt_fgenesh2_pg.C_330011
Domain Number 1 Region: 15-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000687
Family Glutathione S-transferase (GST), N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 151-229
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000682
Family Glutathione S-transferase (GST), C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|295178|estExt_fgenesh2_pg.C_330011
Sequence length 248
Sequence
MLIFYDITSEIPGRAWSPNTWKTRFCLNYKGIPYRTEWVEYPDIEPLCIERGIPPTSYWA
DGKPHYTLPAIHDPSTGTYIADSLLIAEYLDKTYPDTPRIFPRGLEALQLGFVKSFMTQL
DSIWTSIIPQIANHLSPRSLEYFRRTREKSFHKQLEDIAPVGQAQSEAWDLFKRGLDVVN
GWLEKNSASGPFVMADTVSWADFAVGGYLIWMKIVWGEDSQQWKDISSWGEGRWGALIEG
LEKYSEIK
Download sequence
Identical sequences B0DP16
XP_001885678.1.58555 jgi|Lacbi1|295178|estExt_fgenesh2_pg.C_330011 29883.JGI295178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]