SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|295651|estExt_fgenesh2_pg.C_540030 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|295651|estExt_fgenesh2_pg.C_540030
Domain Number 1 Region: 18-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.18e-33
Family PDI-like 0.01
Further Details:      
 
Domain Number 2 Region: 138-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.77e-31
Family PDI-like 0.015
Further Details:      
 
Domain Number 3 Region: 262-359
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.06e-19
Family ERP29 C domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|295651|estExt_fgenesh2_pg.C_540030
Sequence length 369
Sequence
MKFFSVFAALLIGGVSASNVIELTPENFDSVIGKGTPALVEFFAPWCGHCKNLAPIYEQL
ADAYAHAKDKVVIAKVDADGAGKALGKRFEVTGYPTLKWFDANGKESKYESGRDLEALSA
YVTQHSGVKSRIPAPPPTNVVQLDVHNFDSVALDSSKNVLVTFTAPWCGHCKNLKPIYED
IATNFLLESDCVVANIQADDKKNADISEKYGVTGFPTIKFFSKGSKEAEDYDGGRTEGDI
VKFLNEKCGTKRAVGGGLNDEAGRLAQFDELANKFFVAAADIRQTIYKDAVKLAASAGVA
SKHYIRVMEKVVNSSEAYIEKELKRLGAILKKQNLAPSKLDEIKIKINILSAFSEKKADA
KVGRAESEL
Download sequence
Identical sequences B0DWT9
29883.JGI295651 jgi|Lacbi1|295651|estExt_fgenesh2_pg.C_540030 XP_001888384.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]