SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|296671|eu2.Lbscf0010g04800 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|296671|eu2.Lbscf0010g04800
Domain Number 1 Region: 82-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.23e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00046
Further Details:      
 
Domain Number 2 Region: 2-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.48e-28
Family Glutathione S-transferase (GST), N-terminal domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|296671|eu2.Lbscf0010g04800
Sequence length 214
Sequence
MVFKLYGVAFSTCTKRVAIVLHEKNVPFEFHPIDFAAGEHKSPEFLKHQPFGQVPYIEDD
GLVLYESRAICRYIAEKYAGQGTPLIPTELKAKAIFEQATSVEKDNFDALASKAVYEKVF
KPMYGLTPNQETFDELIGNLDKRLDVYDQILSKQKYVAGEEITLADLFHIPYGAMLAAAG
SNILDTKPNVARWWKDITSRSSWIAVEDGVKSTG
Download sequence
Identical sequences B0D9D9
29883.JGI296671 XP_001880544.1.58555 jgi|Lacbi1|296671|eu2.Lbscf0010g04800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]