SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|298606|eu2.Lbscf0014g02190 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|298606|eu2.Lbscf0014g02190
Domain Number 1 Region: 82-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.73e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.00055
Further Details:      
 
Domain Number 2 Region: 2-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.98e-27
Family Glutathione S-transferase (GST), N-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|298606|eu2.Lbscf0014g02190
Sequence length 214
Sequence
MVFKLYGASLSTCTKRVAIVLHEKNVPFEFHPIDFATGQHKSPEYLKYQPFGQVPYIDDD
GFILYESRAICRYIAEKYAGQGTALIPTELKAKAIFEQAASVEKDNFDALAAKAIFEKVF
KPKHGLTPNQELVDELLGNLDKRLDVYNQILSKQKYVAGEEVTLADLFHIPYGALLPAAG
SNLLDTKPNVARWWKDITSRPSWIAVRDGVNSTA
Download sequence
Identical sequences B0DD76
29883.JGI298606 XP_001881822.1.58555 jgi|Lacbi1|298606|eu2.Lbscf0014g02190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]