SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|299218|eu2.Lbscf0016g00120 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|299218|eu2.Lbscf0016g00120
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000135
Family Glutathione S-transferase (GST), N-terminal domain 0.0089
Further Details:      
 
Domain Number 2 Region: 91-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000171
Family Glutathione S-transferase (GST), C-terminal domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|299218|eu2.Lbscf0016g00120
Sequence length 239
Sequence
MTEQITLYTAKICPWAQRVELALQEAKVEYTRYEIDLENKPTWYASKVNPASKVPALAYG
GPKVSPDTPSEESVKLAESGVLLEFVADISGLLLPKDAVSRAKARFFIETATAKFSPAFY
GAVARGESPEGILTVIETIQALLPAEGYAVGEYTIADAAITPLFARANVALKNDIGAYDA
GEGVRVYNILQSDPKFARFRKYYDDVTARDTFKETFHEVSSFRRPMSSVVLTCLRRRSI
Download sequence
Identical sequences B0DEA6
29883.JGI299218 XP_001882270.1.58555 jgi|Lacbi1|299218|eu2.Lbscf0016g00120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]