SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|301005|eu2.Lbscf0001g04540 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|301005|eu2.Lbscf0001g04540
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000028
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|301005|eu2.Lbscf0001g04540
Sequence length 230
Sequence
MPSPPISVFLTTIASQPALRQRQEYLLRILQVKKIPFTSYDLASDEEAKSLWKRKAPLDK
QQLPGILVGGKFPGTFTDFEEAVEYAELDKFFRLNETWNTDIDEERPAPPVKPIGVPGAV
SPLQMTPDHLKTKILAQKSSPLRGKGSAVPIKKREGEFDVSTELSGYGLQGVTATEDELR
DLIEELGLGGDDAGDLLKGLSNSSPEKGDTKSEAGAKASEVDSGSKPTAP
Download sequence
Identical sequences B0CR37
29883.JGI301005 jgi|Lacbi1|301005|eu2.Lbscf0001g04540 XP_001873959.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]