SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|305677|eu2.Lbscf0002g07350 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|305677|eu2.Lbscf0002g07350
Domain Number 1 Region: 24-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-17
Family Selenoprotein W-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|305677|eu2.Lbscf0002g07350
Sequence length 125
Sequence
MPTDSLQNLSDITTFVFPAPLSSTTLVIEFCDRCRWLHRASWVQTELFLTFPPPVIGTIS
LIPLNTDETAGRFRVWLSILGSQAPLLVWDRKVEGGFPELKVLKQRIRDLLQPGKDLGHS
DRKPS
Download sequence
Identical sequences B0CUS6
XP_001874707.1.58555 jgi|Lacbi1|305677|eu2.Lbscf0002g07350 29883.JGI305677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]