SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|307716|eu2.Lbscf0036g01640 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|307716|eu2.Lbscf0036g01640
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.59e-16
Family YKR049C-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|307716|eu2.Lbscf0036g01640
Sequence length 149
Sequence
MTTSSHHPSSPPSIKALNILRASVSGPFPADKPSAPPLEFNLEVIESTPTTDQLKTILSY
LPSKAASPSLVFLSTHPSATERPDTVSGIVELGQKNSNALKWPIVVDWNDGKASVGDVEG
VKGILEILRKKRDGELKDEEVDQPKGWFS
Download sequence
Identical sequences B0DQT3
29883.JGI307716 XP_001886312.1.58555 jgi|Lacbi1|307716|eu2.Lbscf0036g01640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]