SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|308972|eu2.Lbscf0003g06110 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|308972|eu2.Lbscf0003g06110
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.98e-34
Family Glutathione peroxidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|308972|eu2.Lbscf0003g06110
Sequence length 169
Sequence
MSYQSLIGKPAPPITLKNYDGEDYTFTPGATGLPTALFFYPESGSMGCTRQACQFRDAIA
EKDTFKPGKVQIIGISPDPVEKQKAFVEKERLTYPVLSDVDKEVFKTYGIPKGMYGFVAV
ARVTFIVDKKGVVRDALDATMNYGAHSKFVEKWLDKLDGEEELEGTETA
Download sequence
Identical sequences B0CV80
29883.JGI308972 jgi|Lacbi1|308972|eu2.Lbscf0003g06110 XP_001875781.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]