SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|309141|eu2.Lbscf0003g07800 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|309141|eu2.Lbscf0003g07800
Domain Number 1 Region: 5-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.62e-29
Family spliceosomal protein U5-15Kd 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|309141|eu2.Lbscf0003g07800
Sequence length 159
Sequence
MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMMMDETLYSVAEKVQNFAVIYL
VDITEVLDFNKMYELYDPCTVMFFYRYAMCYSRRRRGAELAASNKHIMIDLGTGNNNKIN
WAMDNKQELIDIIETVYRGASKGRGLVVSPKDYSTRYRY
Download sequence
Identical sequences B0CVN2
jgi|Lacbi1|309141|eu2.Lbscf0003g07800 XP_001875861.1.58555 29883.JGI309141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]