SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|314362|eu2.Lbscf0060g00590 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|314362|eu2.Lbscf0060g00590
Domain Number 1 Region: 82-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.34e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00074
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.22e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|314362|eu2.Lbscf0060g00590
Sequence length 214
Sequence
MVLKLYGFHLSTCTRTVATVLHEKQVPFEFIQVDLLKGEQKAPEFVAKQPFGQVPYIDDD
GYILYESRAIARYIATKYANQGTPLLPKDLEAYGLFEQAASVEVHNFNPYASKAVAENVF
KKYRGLNPDPAVYEAAIAALDKNLVVYDQILGKQKYLAGNEITLADIFHVAYGSLLPAAG
SDTIESKPNVDRWFKEVSGRASWQAVKDGVKSTT
Download sequence
Identical sequences B0DYD7
jgi|Lacbi1|314362|eu2.Lbscf0060g00590 XP_001888930.1.58555 29883.JGI314362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]