SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|317765|eu2.Lbscf0087g00230 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|317765|eu2.Lbscf0087g00230
Domain Number 1 Region: 82-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.14e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.00086
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|317765|eu2.Lbscf0087g00230
Sequence length 215
Sequence
MVLKLYGFHLSTCTQTVATVLYEKNVPFEFIPVNISKGEQKAPEYLAIQPFGQVPYIDDD
GYIVYESRAIARYIAAKYADQGTPLLPKDPKAYGLSEQAASIEAFNFHPHTSKPLPKTCS
KSEYRGLTSDPAVYEAAISALDKHLDVYDTILAKQKYLAGDEITLADIFHVAYGSYLPAA
ESNVIESKPNVDRWFKEVSGRASWQAVKDGVKSTA
Download sequence
Identical sequences B0E2B4
29883.JGI317765 XP_001890324.1.58555 jgi|Lacbi1|317765|eu2.Lbscf0087g00230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]