SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|318115|eu2.Lbscf0008g02970 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|318115|eu2.Lbscf0008g02970
Domain Number 1 Region: 136-152,182-260
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000853
Family Glutathione S-transferase (GST), C-terminal domain 0.0095
Further Details:      
 
Domain Number 2 Region: 34-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000175
Family Glutathione S-transferase (GST), N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|318115|eu2.Lbscf0008g02970
Sequence length 266
Sequence
MSRHHHYHASTSRAAAASPPVITLYDVPGHTPQPWAPHIWRVRFILNYKRLLYRTVWVEF
PDVEATLRSIKAQPTGMRSDGRPVYTLPVVVDPMRNPTNPVVVSNPNEIAEYLESAYPAR
PVFPEGSRALQTLFVHFIQEVFSKPLLPIMVPLSHHQLPDRSQAHFRGGAPVPPQLLAAG
PQREQAWLAVKDQFDFLARILEKNCLDGDGVVVMGHDVTYADFALCSVLIWIERMAAHDG
WTRVRTWNNGRWNRLWERCKDYMDEY
Download sequence
Identical sequences B0D612
XP_001879502.1.58555 29883.JGI318115 jgi|Lacbi1|318115|eu2.Lbscf0008g02970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]