SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|318118|eu2.Lbscf0008g03000 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|318118|eu2.Lbscf0008g03000
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.23e-34
Family Glutathione peroxidase-like 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|318118|eu2.Lbscf0008g03000
Sequence length 165
Sequence
MSLKVGDTIPEGSFKYIPYTSELEDSVTTALSTNEWKGKKVVLFSVPGAFTPTCHANHLP
GYLQNYDAFKAKGVDVIAVVAANDAFVMSGWGRFEGVKDKILTLTDTDAKWSASLGLDKD
LSAAGLGHRTWRFAIVIDDLVVKYIGVEPGPGVTVSGASEVLAKL
Download sequence
Identical sequences B0D616
XP_001879250.1.58555 jgi|Lacbi1|318118|eu2.Lbscf0008g03000 29883.JGI318118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]