SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|318240|eu2.Lbscf0008g04220 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|318240|eu2.Lbscf0008g04220
Domain Number 1 Region: 147-232
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.04e-18
Family Thioredoxin-like 2Fe-2S ferredoxin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|318240|eu2.Lbscf0008g04220
Sequence length 264
Sequence
MRSLCRCLQNFPRTLLMRSMGTTAPAVSSEQDLSTEEKPLYGTVASHRSYIFLHSPIPPT
KFPSRMTTTLQRALQLRASKWGGIVNFSWSEGGDDSVDAPQGATVFSALGGRLDLQNLVL
EDVDSVDAVLREHAEGLHPSHPREDTEIHLYVCTHGERDCRCGDMGQKVVSALKKEVMER
GLSADRVRIGEVGHVGGHQYAANVLVFPHGEWLGRVTPETVPDLLTAVLASPRRPFTPSD
PPLLRNHWRGRTGLGKEEQVAFFE
Download sequence
Identical sequences B0D699
jgi|Lacbi1|318240|eu2.Lbscf0008g04220 29883.JGI318240 XP_001879293.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]