SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|318811|eu2.Lbscf0009g01710 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|318811|eu2.Lbscf0009g01710
Domain Number 1 Region: 122-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-17
Family Thioredoxin-like 2Fe-2S ferredoxin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|318811|eu2.Lbscf0009g01710
Sequence length 233
Sequence
MRLCRCLQTFPRTLFMRSTVETPAPAVSSEQDLMTAEKPLYGTDDDASAARFTITRIEVG
RYRQFEGGDHSADAPQEATAFSALGGRLELENIVLEDVDSVYAVLREHTEGLHPSRPHED
TEIRLYVCTHGERDCRCGDMGRKVVSALKKEVKERGASADRVRIEEVGHVGGHQYAANVL
VFPHGEWLGRVTPETVPELLTTVLASPRRPFTPSDPPLLRDHWRGRTGLGKEE
Download sequence
Identical sequences B0D754
jgi|Lacbi1|318811|eu2.Lbscf0009g01710 XP_001879686.1.58555 29883.JGI318811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]