SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|322093|fgenesh3_pg.C_scaffold_2000627 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|322093|fgenesh3_pg.C_scaffold_2000627
Domain Number 1 Region: 81-136
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000257
Family Thioltransferase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|322093|fgenesh3_pg.C_scaffold_2000627
Sequence length 136
Sequence
MPSTTLRSLCRTFVSGSHPVRASKFSLRTFRSTPHRTLVYANADAKIFEQVTTPKDRIAV
LVWPMSSTRAYYRESGLGLPFDLVKVDTESEHGLALGQKYQVTALPTVIAFRDGKPIDKF
VGALREPDVKAFLEKL
Download sequence
Identical sequences B0CS34
XP_001875343.1.58555 jgi|Lacbi1|322093|fgenesh3_pg.C_scaffold_2000627 29883.JGI322093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]