SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|327445|fgenesh3_pg.C_scaffold_12000335 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|327445|fgenesh3_pg.C_scaffold_12000335
Domain Number 1 Region: 32-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000125
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|327445|fgenesh3_pg.C_scaffold_12000335
Sequence length 198
Sequence
MSQARAAAAAGPSRLSTILAHLNASPKLTLSNLKSLRLTMAFRNDHFGARHFVKEHLPRI
RYANPSLDIQVERVKKTQNEVWKPELELVFDNGRRQTINMHEKWSTAIVKEVMEAAGGDA
WQTYKVEAEAAGREVVPGEAGEKSVLVSSGKTKGELLPGLDEFRKALRVKTSATATPSKA
NPSIPPEAISQVEVTASL
Download sequence
Identical sequences B0DB37
29883.JGI327445 XP_001881388.1.58555 jgi|Lacbi1|327445|fgenesh3_pg.C_scaffold_12000335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]