SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|330814|fgenesh3_pg.C_scaffold_29000117 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|330814|fgenesh3_pg.C_scaffold_29000117
Domain Number 1 Region: 132-218
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000314
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 6-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000182
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|330814|fgenesh3_pg.C_scaffold_29000117
Sequence length 227
Sequence
MESTPYTLIGTPFSTFTRTVAMGLRYKGLKYNQVSTPPSSPVAFEHHPFGFLPTLIIHED
QGKRVDVKLRESQAIVRFIDRIAPSPSLHIAPGEGGAVIEEKMWELVSLAACFGYPIVEV
GVVKPRVKAMDEGKLSEEKIRQQLESGVVKLKEFLTLVESLMAPDGFAFGEHPSWADFFL
FPLIADLRALHEWNVVGRRLNEWMGKMDELPAVKETTPGTLAVGARP
Download sequence
Identical sequences B0DMK1
29883.JGI330814 XP_001885092.1.58555 jgi|Lacbi1|330814|fgenesh3_pg.C_scaffold_29000117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]