SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|335939|fgenesh3_pg.C_scaffold_197000001 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|335939|fgenesh3_pg.C_scaffold_197000001
Domain Number 1 Region: 71-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.00079
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000105
Family Glutathione S-transferase (GST), N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|335939|fgenesh3_pg.C_scaffold_197000001
Sequence length 211
Sequence
MDFSTCTQTVATVLYKTNVSFEFIPVDISKGEQKAPEYLVIQPFGQDDDGYIVYESRAIA
RYITAKYGDQGTPLLPKDPKAYGLSEQAASIEAFNFHPHVSKAVAENMFKNGLTPDHAVY
EAAISALDKHLDVYDTILAKQKYLAGDEITLADIFHVAYGSYLPAAGSNVIDTRGKWLSS
PELKPNVDRWFKEVSGRASWQAVKDGVKSXT
Download sequence
Identical sequences B0E3W4
XP_001890882.1.58555 29883.JGI335939 jgi|Lacbi1|335939|fgenesh3_pg.C_scaffold_197000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]