SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|171102|estExt_Genewise1_human.C_20176 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|171102|estExt_Genewise1_human.C_20176
Domain Number 1 Region: 18-73
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000902
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|171102|estExt_Genewise1_human.C_20176
Sequence length 106
Sequence
MSEVFNPTKRPEISTPYDPVHLTHVGFNSSTGEFTGLPKEWQQLLQESGISRSEQEKNPQ
AVMEIVKFYQEGHGEVWDKLGNVGGAIDTAFIAKIGEDGFTNPVSS
Download sequence
Identical sequences B0CTU0
XP_001875114.1.58555 29883.JGI171102 jgi|Lacbi1|171102|estExt_Genewise1_human.C_20176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]