SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|184665|estExt_GeneWisePlus_human.C_100346 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|184665|estExt_GeneWisePlus_human.C_100346
Domain Number 1 Region: 83-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.01e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.29e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|184665|estExt_GeneWisePlus_human.C_100346
Sequence length 215
Sequence
MVIKLYGAVNSTCTKRVAIVLHEKKVPFEFHSIDFSKAENKSPEYLKKQPFGQIPYIDDD
GFILYESRAISRYIAEKYANQGTPGLIPTELKAKAIFEQAASVEKDNFDTFAAKAVYENT
FKPFYGLTPNKAVFDELIATLDKKLDVYDQILSKQKYVAGEEITLADLFHIPYGAILPAA
GSNVIENKPNVDRWFKDITSRPSFLAVKDGVKSSS
Download sequence
Identical sequences B0D843
jgi|Lacbi1|184665|estExt_GeneWisePlus_human.C_100346 29883.JGI184665 XP_001880324.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]